[address-policy-wg] Re: please remove invalid abuse contacts

Hello,

I'm reporting many invalid contact to RIPE, APNIC, AFRINIC, ARIN, LACNIC.

I made an error, the invalid contact which is related to you is:
"abuse at ono.com" for IP 84.127.214.4.

The issue is that the contact admin doesn't solve the abuse I encounter.

Who should I contact if the RIPE database manager tell me he/she can't 
do anything and if you tell me you're not the right working group ?

Thanks for your help.

Regards.


Jérôme Bouat a écrit :
> Hello,
> 
> Your Whois database is providing "jhli_jl at mail.jl.cn" abuse contact
> email for IP 222.160.20.110.
> 
> However, the mailbox is full (see attached error message).
> 
> 
> Please ensure each abuse complaint is processed by each network admin or
> remove useless contacts.
> 
> Sometimes the user account or the domain name is invalid in the provided
> email.
> 
> Thanks for you help.
> 
> Regards.
> 
> 
> ------------------------------------------------------------------------
> 
> Sujet:
> À´×Ô mail.jl.cn µÄÍËÐÅ
> Expéditeur:
> PostMaster at mail.jl.cn <>
> Date:
> Thu, 04 Jun 2009 16:50:21 +0800
> Destinataire:
> jerome.bouat at wanadoo.fr
> 
> Destinataire:
> jerome.bouat at wanadoo.fr
> 
> 
> ÒÔϵÄÓʼþ:
> 
>> ÈÕÆÚ: Thu,  4 Jun 2009 10:56:00 +0200 (CEST)
>> Ö÷Ìâ: Spam Complaint [Msg#14209, IP 222.160.20.110];
>> ´óС: 2683 bytes ×Ö½Ú
>> ¶¯×÷: ʧ°Ü
> 
> ûÓÐÄܹ»·¢Ë͵½ÒÔϵÄÊÕ¼þÈË:
> 
>  jhli_jl:mail "(0), ErrMsg=Too many mails in mailbox. Mail count (3030) reaches or exceeds upper limit (3000)."
> 
> ²»»áÔÙÓÐÈκζ¯×÷À´³¢ÊÔ·¢ËÍÄãµÄÓʼþÁË¡£ ÇëÁªÏµÄãµÄϵͳ¹ÜÀíÔ±»òÏÈͨ¹ýÆäËü·Çµç×ÓÓʼþµÄ·½Ê½ÏòÄãµÄÅóÓÑ·¢ËÍÐÅÏ¢ÒÔÃâµ¢Îó¡£ 
> 
> 
> ------------------------------------------------------------------------
> 
> Sujet:
> Spam Complaint [Msg#14209, IP 222.160.20.110];
> Expéditeur:
> jerome.bouat at wanadoo.fr
> Date:
> Thu, 4 Jun 2009 10:56:00 +0200 (CEST)
> Destinataire:
> abuse at chinaunicom.cn, abuse at cnc-noc.net, jhli_jl at mail.jl.cn
> 
> Destinataire:
> abuse at chinaunicom.cn, abuse at cnc-noc.net, jhli_jl at mail.jl.cn
> 
> 
> I have attached an unsolicited e-mail sent to my computer.  Please investigate and prevent recurrences by acting on your Acceptable Use Policy.
> 
> Your help is greatly appreciated.
> 
> Thank You
> 
> -------- Original Message --------
>>From - Thu Jun  4 10:20:54 2009
> X-Account-Key:account2
> X-UIDL:1186180440.17051
> X-Mozilla-Status:0001
> X-Mozilla-Status2:00000000
> X-Mozilla-Keys:
> Return-Path:<JamesSherman at yyhmail.com>
> Received:from mwinf8208.laposte.net (mwinf8208.laposte.net)
> 	by mwinb7606 (SMTP Server) with LMTP; Thu, 04 Jun 2009 07:50:57 +0200
> X-Sieve:Server Sieve 2.2
> Received:from meplus.info (localhost [127.0.0.1])
> 	by mwinf8208.laposte.net (SMTP Server) with ESMTP id 89C0E240008A;
> 	Thu,  4 Jun 2009 07:50:57 +0200 (CEST)
> Received:from 193.251.214.113 (unknown [222.160.20.110])
> 	by mwinf8208.laposte.net (SMTP Server) with SMTP id 445C72400091;
> 	Thu,  4 Jun 2009 07:50:38 +0200 (CEST)
> X-ME-UUID:20090604055039280.445C72400091 at mwinf8208.laposte.net
> Date:Thu, 04 Jun 2009 01:50:34 -0500
> From:"Le sexe le potentiel +100 %" <LorenWray at amrer.net>
> Message-ID:<QD8965drumlin at innate.com>
> To:jerome.borde at laposte.net
> Subject:*** SPAM ***Re:Votre succ�s sexuel en 15 minutes.
> MIME-Version:1.0
> Content-Type:text/html; charset=iso-8859-1
> Content-Transfer-Encoding:7bit
> X-me-spamlevel:med
> X-me-spamrating:89.099998
> X-me-spamcause:OK, (330)(1000)gggruggvucftvghtrhhoucdtuddrvdekvddrgeekucetggdotefuucfrrhhofhhilhgvmecuoehnohhnvgeqnecuuegrihhlohhuthemuceftddtnecujfhtmhhlqfhnlhihqddqqfdvkedvqdduvdculdeftddtmdennhhouchhohhsthcuuhhrlhculdeftddm
> 
> 
> 
>