[address-policy-wg] Re: please remove invalid abuse contacts
- Previous message (by thread): [address-policy-wg] please remove invalid abuse contacts
- Next message (by thread): [address-policy-wg] Re: please remove invalid abuse contacts
Messages sorted by: [ date ] [ thread ] [ subject ] [ author ]
Jérôme Bouat
jerome.bouat at wanadoo.fr
Thu Jun 4 13:55:28 CEST 2009
Hello, I'm reporting many invalid contact to RIPE, APNIC, AFRINIC, ARIN, LACNIC. I made an error, the invalid contact which is related to you is: "abuse at ono.com" for IP 84.127.214.4. The issue is that the contact admin doesn't solve the abuse I encounter. Who should I contact if the RIPE database manager tell me he/she can't do anything and if you tell me you're not the right working group ? Thanks for your help. Regards. Jérôme Bouat a écrit : > Hello, > > Your Whois database is providing "jhli_jl at mail.jl.cn" abuse contact > email for IP 222.160.20.110. > > However, the mailbox is full (see attached error message). > > > Please ensure each abuse complaint is processed by each network admin or > remove useless contacts. > > Sometimes the user account or the domain name is invalid in the provided > email. > > Thanks for you help. > > Regards. > > > ------------------------------------------------------------------------ > > Sujet: > À´×Ô mail.jl.cn µÄÍËÐÅ > Expéditeur: > PostMaster at mail.jl.cn <> > Date: > Thu, 04 Jun 2009 16:50:21 +0800 > Destinataire: > jerome.bouat at wanadoo.fr > > Destinataire: > jerome.bouat at wanadoo.fr > > > ÒÔϵÄÓʼþ: > >> ÈÕÆÚ: Thu, 4 Jun 2009 10:56:00 +0200 (CEST) >> Ö÷Ìâ: Spam Complaint [Msg#14209, IP 222.160.20.110]; >> ´óС: 2683 bytes ×Ö½Ú >> ¶¯×÷: ʧ°Ü > > ûÓÐÄܹ»·¢Ë͵½ÒÔϵÄÊÕ¼þÈË: > > jhli_jl:mail "(0), ErrMsg=Too many mails in mailbox. Mail count (3030) reaches or exceeds upper limit (3000)." > > ²»»áÔÙÓÐÈκζ¯×÷À´³¢ÊÔ·¢ËÍÄãµÄÓʼþÁË¡£ ÇëÁªÏµÄãµÄϵͳ¹ÜÀíÔ±»òÏÈͨ¹ýÆäËü·Çµç×ÓÓʼþµÄ·½Ê½ÏòÄãµÄÅóÓÑ·¢ËÍÐÅÏ¢ÒÔÃâµ¢Îó¡£ > > > ------------------------------------------------------------------------ > > Sujet: > Spam Complaint [Msg#14209, IP 222.160.20.110]; > Expéditeur: > jerome.bouat at wanadoo.fr > Date: > Thu, 4 Jun 2009 10:56:00 +0200 (CEST) > Destinataire: > abuse at chinaunicom.cn, abuse at cnc-noc.net, jhli_jl at mail.jl.cn > > Destinataire: > abuse at chinaunicom.cn, abuse at cnc-noc.net, jhli_jl at mail.jl.cn > > > I have attached an unsolicited e-mail sent to my computer. Please investigate and prevent recurrences by acting on your Acceptable Use Policy. > > Your help is greatly appreciated. > > Thank You > > -------- Original Message -------- >>From - Thu Jun 4 10:20:54 2009 > X-Account-Key:account2 > X-UIDL:1186180440.17051 > X-Mozilla-Status:0001 > X-Mozilla-Status2:00000000 > X-Mozilla-Keys: > Return-Path:<JamesSherman at yyhmail.com> > Received:from mwinf8208.laposte.net (mwinf8208.laposte.net) > by mwinb7606 (SMTP Server) with LMTP; Thu, 04 Jun 2009 07:50:57 +0200 > X-Sieve:Server Sieve 2.2 > Received:from meplus.info (localhost [127.0.0.1]) > by mwinf8208.laposte.net (SMTP Server) with ESMTP id 89C0E240008A; > Thu, 4 Jun 2009 07:50:57 +0200 (CEST) > Received:from 193.251.214.113 (unknown [222.160.20.110]) > by mwinf8208.laposte.net (SMTP Server) with SMTP id 445C72400091; > Thu, 4 Jun 2009 07:50:38 +0200 (CEST) > X-ME-UUID:20090604055039280.445C72400091 at mwinf8208.laposte.net > Date:Thu, 04 Jun 2009 01:50:34 -0500 > From:"Le sexe le potentiel +100 %" <LorenWray at amrer.net> > Message-ID:<QD8965drumlin at innate.com> > To:jerome.borde at laposte.net > Subject:*** SPAM ***Re:Votre succ�s sexuel en 15 minutes. > MIME-Version:1.0 > Content-Type:text/html; charset=iso-8859-1 > Content-Transfer-Encoding:7bit > X-me-spamlevel:med > X-me-spamrating:89.099998 > X-me-spamcause:OK, (330)(1000)gggruggvucftvghtrhhoucdtuddrvdekvddrgeekucetggdotefuucfrrhhofhhilhgvmecuoehnohhnvgeqnecuuegrihhlohhuthemuceftddtnecujfhtmhhlqfhnlhihqddqqfdvkedvqdduvdculdeftddtmdennhhouchhohhsthcuuhhrlhculdeftddm > > > >
- Previous message (by thread): [address-policy-wg] please remove invalid abuse contacts
- Next message (by thread): [address-policy-wg] Re: please remove invalid abuse contacts
Messages sorted by: [ date ] [ thread ] [ subject ] [ author ]